PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000284846
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 523aa    MW: 59302.9 Da    PI: 8.487
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000284846genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.34e-14245291148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g W++eEd  lv++v  +G + W+ Ia  +  gR +kqc++rw+++l
    MDP0000284846 245 KGQWSPEEDRHLVQLVGXFGIKKWSQIATQLT-GRVGKQCRERWHNHL 291
                      799****************************9.*************97 PP

2Myb_DNA-binding58.81.2e-18299341347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       W++eEd++l++a+k+ G++ W+ Ia++++ gRt++ +k++w++y
    MDP0000284846 299 MWSEEEDKILIEAHKEIGNR-WSEIAKMLP-GRTENTIKNHWNDY 341
                      6*******************.*********.************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.24240295IPR017930Myb domain
SuperFamilySSF466893.1E-31242338IPR009057Homeodomain-like
SMARTSM007171.2E-11244293IPR001005SANT/Myb domain
PfamPF002491.0E-12245291IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-24246296IPR009057Homeodomain-like
CDDcd001673.55E-11248291No hitNo description
PROSITE profilePS5129420.981296346IPR017930Myb domain
SMARTSM007174.0E-15296344IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-22297343IPR009057Homeodomain-like
PfamPF002491.8E-17298341IPR001005SANT/Myb domain
CDDcd001671.66E-13300342No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MDYLETNLRE LDNFPFLSTL LSGSSNPLKL MKPENPPPST TTINGNIYSV SRSSPPPPNS  60
PKXLFHHXNS TIHGFNWNSH SHEYNXTPKI NHFTTTEAGS SSNPFSKIST TCNTLNNPLE  120
PSPYTPNHHH HDFVTSDCRE SESGVMHGFH GGVRGFLGYQ PHHQKILHDQ QMGAQSCVQL  180
PQLVNYGEFG SSSVPAXRLP SDDVSSNSII AEIEFGRRFS ADEKNKRLCA RRAIKMLQKK  240
PDIIKGQWSP EEDRHLVQLV GXFGIKKWSQ IATQLTGRVG KQCRERWHNH LRPDIRKEMW  300
SEEEDKILIE AHKEIGNRWS EIAKMLPGRT ENTIKNHWND YIRSLVGTTA TDTTASPNFT  360
GTTENKAGLS SVVSPDHQSG XHIDQNNIVE SPDATNSANW DLMGYRPXPI DSEASNMNNY  420
MSGMASSSTS RVKDLSCNME YELPFLPLET NNFMQGHDNH VKKELDIMEM LHFKGKEVLY  480
LARNSCDGFL KSRKLKVPRK KVSNMHKWRS CLCHVGRTRI PHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-442413483110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008379787.10.0PREDICTED: transcription factor MYB98
TrEMBLM5X7L25e-91M5X7L2_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1709548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.14e-53myb domain protein 118